Everything below concerns GW501516. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2025-11-20. Numbers and descriptions here follow the published literature rather than marketing material.
The compound is typically described as a laboratory compound rather than a therapeutic product. Published reports have explored its role in lipid disorders, insulin sensitivity, and exercise metabolism, yet no major drug regulator has approved it for medical use. Commercial samples sold under the cardarine name may vary in purity and identity. Analytical confirmation is therefore necessary when the material is discussed in scientific or regulatory contexts. Its classification as a prohibited substance in sport further shapes how it is studied and reported.
Cardarine is a common name for GW501516, a synthetic compound studied for its effects on lipid and glucose metabolism. It functions as an agonist at peroxisome proliferator-activated receptor delta, or PPARδ, a nuclear receptor that influences gene expression. The molecule is not a steroid, nor is it a selective androgen receptor modulator. It is also known in research and sports literature as GW-501516 and endurobol. Early laboratory work examined its metabolic activity in cell cultures and animal models.
The pharmacological interest in cardarine centers on PPARδ activation and its downstream effects on lipid handling and mitochondrial function. In animal studies, PPARδ agonists have been associated with changes in exercise endurance and fatty acid utilization, though results vary by model and protocol. Human data remain sparse, and the absence of large controlled trials limits conclusions about efficacy. Researchers often describe the compound as a tool for probing PPARδ biology rather than a proven therapeutic agent.
Safety discussions about cardarine frequently cite rodent carcinogenicity findings reported in the 2000s. In those studies, treated animals developed tumors at multiple sites, leading sponsors to discontinue clinical development. The relevance of these findings to humans has not been resolved, but they are a major reason the compound is not approved. Current literature emphasizes uncertainty about long-term effects and the risks of unregulated use. Regulators and health agencies have not established a safe human exposure level.
Cardarine is a synthetic compound also known as GW501516, GW-501516, and sometimes endurobol. It was developed as a selective agonist of peroxisome proliferator-activated receptor delta, a nuclear receptor involved in fatty acid oxidation and energy metabolism. The compound was studied in preclinical models for metabolic and cardiovascular conditions, but it did not become a marketed human medicine. In regulatory and anti-doping contexts, it is treated as a prohibited substance rather than a licensed medicine.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic PPARδ agonist | Not a steroid or a selective androgen receptor modulator. |
| Common synonyms | Cardarine, GW501516, GW-501516, endurobol | Names vary by supplier and literature source. |
| Appearance | White to off-white powder | Consistent with many small-molecule research chemicals. |
| Solubility | Low in water; soluble in DMSO and ethanol | Often prepared in organic solvent for laboratory work. |
| Primary target | PPARδ (NR1C2) | Nuclear receptor involved in lipid and energy metabolism. |
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Cardarine is a common name for GW501516, a synthetic compound developed in the 1990s through research collaborations involving GlaxoSmithKline. It belongs to a class of molecules known as peroxisome proliferator-activated receptor delta agonists. Early studies explored its effects on lipid metabolism and energy expenditure in animal models. The compound was never approved as a human medicine, and clinical development was discontinued. In the years since, it has appeared in fitness and bodybuilding communities as a performance-enhancing substance. Regulatory agencies classify it as an unapproved drug.
PPARδ is a nuclear receptor that regulates gene expression related to fatty acid oxidation, glucose homeostasis, and mitochondrial function. GW501516 binds to this receptor with high affinity and activates downstream signaling in skeletal muscle and other tissues. Animal studies reported increased endurance and altered fuel preference, but human data remain limited and inconsistent. The precise relationship between receptor activation and observed physiological changes is still an area of active investigation. Researchers have also examined whether the compound affects inflammation or cell proliferation. No approved therapeutic indication exists for cardarine.
In laboratory settings, cardarine is studied as a tool compound for probing PPARδ biology. Published experiments often use cell cultures, rodent models, or isolated tissues. Some investigations focus on metabolic effects, while others assess potential risks such as carcinogenicity observed in long-term animal studies. Because human trials are sparse, most knowledge comes from preclinical work and adverse event reports. Scientific literature frequently notes the gap between animal findings and human outcomes. The compound is not a dietary supplement and is not intended for human consumption.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
== Monitoring and improvement == Stewardship programs use laboratory utilization data to identify opportunities for improvement and evaluate interventions. Monitoring may include the appropriateness of test orders, retrieval of results, interpretation of results, test volumes, costs, and the effects of individual interventions. Broader measures of impact may include blood collection volumes, length of stay, readmission, morbidity, and mortality. Data-driven approaches can also use implementation science to identify behavioral and organizational factors that influence laboratory test use and to select interventions suited to those factors. Laboratory stewardship programs use multidisciplinary teams and laboratory utilization data to identify inappropriate testing and opportunities for improvement, implement interventions, and assess their effects. Programs can be organized differently depending on institutional priorities, available resources, and the clinical setting. Laboratory stewardship has also been discussed as a means of addressing health equity in laboratory testing.
== Use == A common way to synthesize an NHS-activated acid is to mix NHS with the desired carboxylic acid and a small amount of an organic base in an anhydrous solvent. A coupling reagent such as dicyclohexylcarbodiimide (DCC) or 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC) is then added to form a highly reactive activated acid intermediate. NHS reacts to create a less labile activated acid. The group is usually written as SuO- or -OSu in chemical notation. Such an ester with acid and NHS, sometimes called succinate ester, is stable enough to be purified and stored at low temperatures in the absence of water and, as such, is commercially available. NHS esters are commonly used for protein modification (e.g. an NHS ester of fluorescein is commercially available, and can be added to a protein to obtain a fluorescently labeled protein in a straightforward reaction and purification step). NHS can be used with EDC to immobilize enzymes for biosensor applications.
==== Bromantane ==== Bromantane is a stimulant drug with anxiolytic properties developed in Russia during the late 1980s. Bromantane acts mainly by facilitating the biosynthesis of dopamine, through indirect genomic upregulation of relevant enzymes (tyrosine hydroxylase (TH) and aromatic L-amino acid decarboxylase (AAAD)).
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
Sources: en.wikipedia.org
=== Late modern botany === Building upon the gene-chromosome theory of heredity that originated with Gregor Mendel (1822–1884), August Weismann (1834–1914) proved that inheritance only takes place through gametes. No other cells can pass on inherited characters. The work of Katherine Esau (1898–1997) on plant anatomy is still a major foundation of modern botany. Her books Plant Anatomy and Anatomy of Seed Plants have been key plant structural biology texts for more than half a century.
==== Unmarked grave ==== In many cultures graves are marked with durable markers, or monuments, intended to help remind people of the buried person. An unmarked grave is a grave with no such memorial marker.
==== Financial inclusion ==== Digital agriculture technologies can expand farmers' access to credit, insurance, and bank accounts for a number of reasons. First, digital technology helps alleviate the information asymmetry that exists between farmers and financial institutions. When lenders decide a farmer's credit ceiling or insurance premium, they are usually uncertain about what risks the farmer presents. Digital technology reduces the costs of verifying farmers' expected riskiness. The Kenyan company M-Shwari uses customers' phone and mobile money records to assess creditworthiness. Organizations like FarmDrive and Apollo Agriculture incorporate satellite imagery, weather forecasts, and remote sensor data when calculating farmers' loan eligibility. Drone imagery can confirm a farmer's physical assets or land use and Asset tracking using RFID technology allows stakeholders to monitor livestock, making it easier for insurers to understand farmers' riskiness. In all instances, low-cost digital verification reduces lenders' uncertainty: the questions "will this farmer repay the loan?" and "what risks does this farmer face?" become clearer. Second, digital technology facilitates trust between farmers and financial institutions. A range of tools create trust, including real-time digital communication platforms and blockchain/distributed ledger technology/smart contracts. In Senegal, a digitalized, supply-chain-tracking system allows farmers to collateralize their rice to obtain the credit necessary for planting.
Sources: en.wikipedia.org
=== First nucleotide recognition === The NIKS site is responsible for binding with the first nucleotide of the stop codon: uracil. This is achieved by the Asn61 and Lys63 residues of NIKS forming hydrogen bonds with the carbonyl group of the uracil. A secondary hydrogen bond is formed between the Asn61 residue with a different carbonyl found on uracil. Additionally it has been hypothesized that the lys63 residue interacts with the backbone of the mRNA which contributes to stability and proper alignment of eRF1. The specificity of the mechanism for uracil means that any other nucleotide (guanine, adenosine, thymine, cytosine) will produce a structure that doesn't have extensive hydrogen bonding to stabilize the docking of eRF1.
== Names == The war is also known under other names, such as the Second Gulf War (not to be confused with the 2003 Iraq War, also referred to as such), Persian Gulf War, Kuwait War, or Iraq War before the term "Iraq War" became identified with the 2003 Iraq War, also known in the US as "Operation Iraqi Freedom". The war was named Umm al-Ma'arik ("mother of all battles") by Iraqi officials. After the US invasion of Iraq in 2003, the Gulf War of 1990–1991 is often known as the "First Iraq War". The following names have been used to describe the conflict itself: Gulf War and Persian Gulf War are the most common terms for the conflict used within western countries. It may also be called the First Gulf War, to distinguish it from the 2003 invasion of Iraq and the subsequent Iraq War. Some authors have called it the Second Gulf War to distinguish it from the Iran–Iraq War. Liberation of Kuwait (Arabic: تحرير الكويت) (taḥrīr al-kuwayt) is the term used by Kuwait and most of the coalition's Arab states, including Saudi Arabia, Bahrain, Egypt, and the United Arab Emirates. Terms in other languages include French: la Guerre du Golfe and Guerre du Koweït (War of Kuwait); German: Golfkrieg (Gulf War) and Zweiter Golfkrieg (Second Gulf War).
==== Egg ==== The cabbage looper eggs are generally yellow-white in color, dome-shaped, and patterned with ridges. They are 0.6mm in diameter and 0.4mm in height, and they are usually laid singly on the underside of leaves. In one day, 40–50 females can lay 1000–2000 viable eggs. Viable eggs hatch after about three days, while unviable eggs fail to develop and collapse within that period. Eggs are mostly found on leaves that are both larger and higher on the plant. It is not clear why eggs are preferentially laid on these leaves.
Sources: en.wikipedia.org
Cardarine is a common name for GW501516, a synthetic PPARδ agonist. It is not a steroid or a selective androgen receptor modulator. It was developed and studied as a research compound for metabolic pathways.
It binds to and activates PPARδ, a nuclear receptor that regulates genes related to fatty acid oxidation and energy use. This activation alters transcription in tissues such as skeletal muscle and liver. The full range of downstream effects in humans is not fully established.
No, cardarine is not known to occur naturally in plants, animals, or humans. It is a synthetic molecule produced for laboratory research. Products labeled as cardarine should therefore be treated as manufactured chemicals with variable purity.
Cardarine is an investigational synthetic compound that acts as a PPARδ agonist. It is also known as GW501516 and has been studied mainly in preclinical research. It is not an approved medicine.